PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_013619583.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family MYB
Protein Properties Length: 285aa    MW: 33025.9 Da    PI: 6.0519
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_013619583.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding51.13e-162067148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     rg+WT eEd ll +++ q   g+W+++a++ g++Rt+k+c++rw++yl
   XP_013619583.1 20 RGPWTLEEDTLLTNYIIQSSEGRWNLVAKCAGLKRTGKSCRLRWLNYL 67
                     89********************************************97 PP

2Myb_DNA-binding51.22.8e-1673116146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      rg+ +++E++l++d++ ++G++ W++Ia++++ gRt++++k++w++
   XP_013619583.1  73 RGNLSPQEQLLILDLHSKWGNR-WSKIAQYLP-GRTDNEIKNYWRT 116
                      7899******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129411.8411567IPR017930Myb domain
SuperFamilySSF466895.5E-2917114IPR009057Homeodomain-like
SMARTSM007172.2E-131969IPR001005SANT/Myb domain
PfamPF002496.8E-142067IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.607.0E-212174IPR009057Homeodomain-like
CDDcd001671.30E-92267No hitNo description
PROSITE profilePS5129424.47568122IPR017930Myb domain
SMARTSM007174.9E-1472120IPR001005SANT/Myb domain
PfamPF002495.0E-1573116IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.1E-2275121IPR009057Homeodomain-like
CDDcd001678.59E-1177116No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009686Biological Processgibberellin biosynthetic process
GO:0009751Biological Processresponse to salicylic acid
GO:0016036Biological Processcellular response to phosphate starvation
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 285 aa     Download sequence    Send to blast
MENSMKKKTF TESEEVELRR GPWTLEEDTL LTNYIIQSSE GRWNLVAKCA GLKRTGKSCR  60
LRWLNYLKPD IRRGNLSPQE QLLILDLHSK WGNRWSKIAQ YLPGRTDNEI KNYWRTRVQK  120
QARQLNIESN SDKFFDAVRS FWVPRLIEKM EQKPSNTYCC PQNNNNNNNS LLPPSQSYDS  180
MSKQTYTDIS GKNLGISNTD GSASSSTSMP DLMTVPHFMD HNTIIDSSMC YHEGNGQELG  240
GYIPGMEEYY MRNSDISTDC HVAEAYEDVT QDPMWNVDDI WQFRG
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1gv2_A4e-23171221105MYB PROTO-ONCOGENE PROTEIN
1h8a_C6e-231712224128MYB TRANSFORMING PROTEIN
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00216DAPTransfer from AT1G68320Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKM9756551e-178KM975655.1 Brassica napus MYB transcription factor 62.1 (MYB62.1) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013619583.10.0PREDICTED: transcription factor MYB24-like
TrEMBLA0A0D3ANX20.0A0A0D3ANX2_BRAOL; Uncharacterized protein
STRINGBra033948.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM26322571
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G68320.11e-148myb domain protein 62